PTM Viewer PTM Viewer

AT5G60490.1

Arabidopsis thaliana [ath]

FASCICLIN-like arabinogalactan-protein 12

No PTMs currently found

PLAZA: AT5G60490
Gene Family: HOM05D000656
Other Names: AtFLA12; FLA12

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 249

MEHSLIILLFTVLLLLTTTPGILSQPSPAVAPAPPGPTNVTKILEKAGQFTVFIRLLKSTGVANQLYGQLNNSDNGITIFAPSDSSFTGLKAGTLNSLTDEQQVELIQFHVIPSYVSSSNFQTISNPLRTQAGDSADGHFPLNVTTSGNTVNITSGVTNTTVSGNVYSDGQLAVYQVDKVLLPQQVFDPRPPAPAPAPSVSKSKKKKDDSDSSSDDSPADASFALRNVGSVCDAVSFCVMSVMLAWFYL

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR000782 37 184
Molecule Processing
Show Type From To
Propeptide 221 249
Signal Peptide 1 24

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here